compound
TB-500
A seven amino acid synthetic peptide sold under a larger protein's research record, covered claim by claim: what tested the fragment, what tested something else, and where the compounding and anti-doping records stand.
- Primary sources Registry records and papers are read at the source, not through summaries. Read the methodology
- Every claim graded Each claim about what a compound does carries an evidence tier and a numbered citation. How grades derive
- Sells nothing No cart, no price, and no product page anywhere on this site. Conflict disclosure
- Corrections logged Errors are fixed and recorded in a permanent public log, never edited away. Corrections log
TB-500 is a synthetic peptide seven amino acids long. A doping-control laboratory that analysed marketed product identified it as Ac-LKKTETQ: leucine, lysine, lysine, threonine, glutamate, threonine and glutamine, with an acetyl group attached to the leucine at the front [1]. Those seven residues are positions 17 to 23 of thymosin beta-4, a 43 residue protein the body makes throughout its tissues, and the reason anyone assembled them into a separate molecule is that the stretch is the part of the protein that binds actin, the structural filament cells use to hold their shape and to move [2].
What it is sold for is injury: tendon, muscle and ligament recovery, injected. FDA compiled the full marketed claim set from fourteen vendor and clinic websites for its 2026 evaluation, and it runs well past that, through wound healing, angiogenesis, cardiovascular health, hair growth, neurogenesis and immune function [20]. Every one of those claim areas is graded separately below.
Two identity questions decide what any of the published record is evidence for, and this page turns on both. The first is the one the market blurs: thymosin beta-4 has a clinical programme and TB-500 is a fragment of it, so the protein's trials belong to the protein. FDA states the rule in its own footnote, that thymosin beta-4 and TB-500 are not the same substance [20]. The second is finer and it cuts through the fragment's own literature: FDA also holds that the pharmacological profile of the plain heptapeptide LKKTETQ cannot be carried across to the acetylated form that is actually sold [20]. The reference list runs to 29 numbered sources: 19 primary papers and reviews with every identifier transcribed from its PubMed record, five FDA documents read in full with their page counts checked, three registry reads through the ClinicalTrials.gov API, the 2026 Prohibited List read from the primary PDF, and one protein database record. The regulatory section is current to 9 August 2026.
| Property | Value | Source |
|---|---|---|
| Category | Synthetic protein fragment, sold as an injectable for injury recovery | PMID 22962027 |
| Also known as | Ac-LKKTETQ, thymosin beta-4 (17-23) fragment, TB-500 acetate, TB500, TB-1000 | FDA review, 2026 |
| Sequence | Ac-Leu-Lys-Lys-Thr-Glu-Thr-Gln, residues 17 to 23 of the mature protein with a synthetic acetyl group at the front | PMID 23084823 |
| Molecular formula | C38H68N10O14, giving 889.01 g/mol for the free base. The acetate salt is a separate bulk drug substance and FDA records no CAS number and no UNII of its own for it | FDA review, 2026 |
| CAS number | 885340-08-9 for the free base. FDA notes that several suppliers reuse that number for the acetate, which is a different substance | FDA review, 2026 |
| UNII code | QHK6Z47GTG, for the free base | FDA review, 2026 |
| Parent protein | Thymosin beta-4, a 43 residue mature chain with the sequence beginning SDKPDMAEIEK. Counting from that first serine, residues 17 to 23 are LKKTETQ | NCBI Protein P62328 |
| Present in the body | The parent protein is, throughout the tissues. Ac-LKKTETQ is a synthetic molecule and the acetyl group it carries is not something the protein has at that position, so the compound itself is not endogenous | PMID 23084823 |
| Molecular target | Actin, inferred from the parent protein. The 17 to 23 stretch plus the terminal glutamine is described as the central actin-binding domain of thymosin beta-4, and that description comes from work on the protein rather than on the acetylated fragment | PMID 20179146 |
| Half-life in people | Never measured. FDA states it did not identify clinical studies in humans assessing the pharmacokinetics or pharmacodynamics of either form by any route | FDA review, 2026 |
| Routes with published work | Into the abdominal cavity in rats, under the skin in horses, and onto an eye inside an engineered gel. A fourth animal study gave it with a second peptide and its abstract states no route. Cell culture besides. No human route has been studied | PMID 38382158 |
| Completed human trials | 0 | FDA review, 2026 |
| Registered human trials | One registry record names TB-500, and its own registered brief summary states that it is a fictional example of a ClinicalTrials.gov-style record. The human-record section reads it in full | NCT07487363 |
| FDA 503A Bulks List | Not on the list. FDA proposed against adding either form, the advisory committee took both up on 23 July 2026, and no vote record has been published. The 503A record on this site sets out the meeting | FDA briefing document |
| FDA 503A safety-risk list | Listed in category 2 as Thymosin beta-4, fragment (LKKTETQ), also known as TB-500, for immunogenicity and aggregation risk. Page content current 22 April 2026 | FDA category 2 record |
| WADA 2026 | Named on the face of the Prohibited List at class S2.3, in the entry reading Thymosin-ß4 and its derivatives e.g. TB-500. Prohibited at all times, and every substance in class S2 is a non-Specified Substance | FDA presentation, TB-500 section slide 26 |
Not medical advice
This page reports what has been documented about a compound. It is not medical advice, not a diagnosis, not a dosing protocol, and not a recommendation to obtain or use anything described here. Talk to a licensed clinician about anything concerning your health. Read the full disclaimer.
Reviewed against editorial standards Updated
Key takeaways
- TB-500 and thymosin beta-4 are two molecules of very different size, and FDA says so in its own evaluation: several websites use the terms interchangeably, and the agency records that the two are not the same substance.
- No human being has been given TB-500 in any published study, for any purpose, by any route. FDA searched PubMed, Embase, ClinicalTrials.gov, DailyMed, Drugs@FDA and professional-society sources and stated the same finding twice, in two separate documents.
- One registry record names TB-500, and its registered brief summary opens by stating that it is a fictional study and an example of a ClinicalTrials.gov-style record. It has posted no results, and on the registry as read on 9 August 2026 it is the only record naming the compound.
- The whole published record in the tissue TB-500 is sold for is one rat Achilles tendon study with eight animals per group, delivered into the abdominal cavity, whose own authors call it an exploratory rat model study and ask for longer follow-up. [Animal] [4]
- In the one direct laboratory test of the marketed use, TB-500 did not close scratched fibroblast cultures at the concentration tested, while one of its own breakdown products, Ac-LKKTE, did. The paper's authors propose that the wound-healing activity reported in the literature belongs to the metabolite rather than to the parent fragment. [In-vitro] [5] [20]
- FDA draws a second identity line the market does not: because acetylation changes a peptide's charge, water-repellency and size, the agency holds that the profile of the plain heptapeptide LKKTETQ cannot be carried across to the acetylated form sold as TB-500. The 2003 aged-mouse study behind most of the wound-healing reputation used the plain form.
- There is no toxicology package for either form: no acute study, no repeat-dose study, no genotoxicity study, no reproductive and developmental study and no carcinogenicity study was submitted with the nomination or found by FDA.
- FDA lists Thymosin beta-4, fragment (LKKTETQ), also known as TB-500, in the 503A category for substances that may present significant safety risks, citing immunogenicity, aggregation and peptide-related impurities, and stating that it has identified no human exposure data at all.
- TB-500 is named on the face of the 2026 WADA Prohibited List at class S2.3, by its own name, as the example given in the thymosin beta-4 entry. That class is prohibited in and out of competition, and every substance in it is a non-Specified Substance, which is the harsher of the two sanctioning categories.
- SEQUENCE
- Ac-LKKTETQ
- COMPLETED HUMAN TRIALS
- 0
- NUMBERED SOURCES
- 29
- EVIDENCE GRADE
- D
Who researches TB-500?
Three groups arrive at this compound, and the published record answers them very differently.
The largest is reading about a tendon, a muscle or a ligament, usually after an injury that is healing slowly. That interest is what the product is built around, and the entire published record in those tissues is one rat study of a surgically cut Achilles tendon with eight animals in the treated group. There is no registered trial of either molecule in tendon, muscle or ligament, which is a short sentence covering a wide gap.
The second group arrives having already read a trial count. Search engines and vendor pages attach the thymosin beta-4 registrations to the fragment, so a reader can reach a page listing a phase 3 programme with the right-sounding name on it. Those registrations exist and they were run in eyes and in skin. The human-record section below lists all of them with what each one tested, so the count can be checked rather than repeated.
The third group is a tested athlete, or somebody advising one. That question has the clearest answer on this page and it does not depend on the evidence at all: the compound is named on the Prohibited List by its own name, and the anti-doping section sets out the class, the sanctioning category and what has been published about detection.
What is TB-500?
Plain-English version: a chain of seven amino acids copied out of the middle of a much larger protein, with a chemical cap added to one end that the protein does not carry there.
Thymosin beta-4 is a small protein. The reference record for accession P62328 carries a 44 residue precursor whose annotated mature chain runs from residue 2 to residue 44, giving the 43 residue protein with the sequence SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES [29]. Counting from that first serine, residues 17 to 23 read LKKTETQ, and a 2010 review from the group that characterised the protein describes that stretch plus its terminal glutamine as the central actin-binding domain [2].
TB-500 is those seven residues with a synthetic acetyl group on the leucine at the front: Ac-Leu-Lys-Lys-Thr-Glu-Thr-Gln. FDA gives it the UNII code QHK6Z47GTG, the CAS number 885340-08-9, the formula C38H68N10O14 and a molecular weight of 889.01, and treats the acetate salt as a separate bulk drug substance with no identifier of its own [20]. Two independent laboratories established the identity from marketed product rather than from a supplier's claim: a 2012 doping-control paper isolated the compound from a product sold under the name, characterised it by high-resolution mass spectrometry, and then synthesised it separately to confirm the match [1], and a second 2012 paper analysing a veterinary preparation reported the same, LKKTETQ with an artificial acetyl group at the N-terminus [6].
That acetyl group is small and it is not cosmetic. FDA's evaluation quotes the reason directly: acetylation permanently alters a peptide's charge, its water-repellency and its size, which can change how long it lasts, how it folds and what it binds to [20]. The agency's conclusion from that is the one this page carries throughout, that a result obtained with the plain heptapeptide does not transfer to the acetylated one.
A third identity question applies to the container rather than to the chemistry. A 2023 analysis of products sold online under these names reports that their content is not consistently what the descriptions say it is [9], and FDA reaches the same place from the paperwork side: TB-500 is a common name rather than a USAN, INN or IUPAC name, and the agency records having encountered multiple salts and derivatives, including different active moieties, sold commercially under it [20].
Ac-LKKTETQ · C38H68N10O14, 889.01 g/mol for the free base
How strong is the evidence, claim by claim?
Every claim area this compound is discussed for gets a row, including the ones with the weakest support. The tier records what the row rests on, and the last column states what that work can and cannot show. Each tier links to its definition on the methodology page.
| Evidence Area | What Has Been Studied | Evidence Level | What It Can and Cannot Show |
|---|---|---|---|
| Tendon, muscle and ligament recovery | One rat study, published 23 July 2026 and the only result of any kind in the tissues this compound is sold for. Thirty-two male Sprague-Dawley rats, twelve weeks old, had an Achilles tendon cut across and repaired, then were split into four groups of eight: control, BPC-157, TB-500, and both together. Treatment went into the abdominal cavity and ran for four weeks. Maximum load to failure, two histological degeneration scales and collagen expression were measured at the end [4] | [Animal] | Supports a higher maximum load to failure and lower scores on two degeneration scales in a cut rat tendon after four weeks of laboratory dosing. Does not show anything about a human tendon injury, at any amount, by any route: eight animals per arm, a route nobody uses, a young healthy animal, and an injury made on purpose rather than sustained. The authors call it an exploratory rat model study and ask for dose optimisation and longer follow-up themselves. The combined group added nothing over either agent alone, and collagen I expression did not differ between any of the four groups |
| Whether an injected amount reaches the circulation | One study, in horses, run by a doping-control laboratory rather than a pharmacology one. TB-500 free base was given under the skin to thoroughbred geldings, and plasma and urine were tracked by liquid chromatography mass spectrometry. The measured peaks are in the benefits section below, in picograms per millilitre, along with what was recovered from urine [6] | [Animal] | Supports the finding that a subcutaneous amount of TB-500 reaches a horse's circulation, briefly, at concentrations measured in tens of picograms per millilitre. Does not establish bioavailability, because no intravenous arm was run, and does not transfer to a person, since no pharmacokinetic study of this compound in a human being has been published on any route. It also measures blood rather than tissue: nothing has measured what reaches a tendon in any species |
| Neurogenesis, cognition and inflammation in the brain | One 2026 mouse study, in a transgenic model of Alzheimer's disease and in three cell systems. TB500 was reported together with Ac-SDKP, a different fragment cut from the front of the same parent protein, with improvements in two memory tasks, reduced glial activation and restored axonal density in the perirhinal cortex. Amyloid burden in the hippocampus was unchanged [8] | [Animal] | Supports a set of measured changes in a genetically modified mouse given two peptides at once. Does not isolate TB-500, because the two are reported together throughout and no arm separates them, and does not speak to the marketed use, which is musculoskeletal rather than cognitive. A transgenic mouse model of dementia is a construction rather than the disease, and the amyloid result went the other way |
| Corneal and eye repair | One 2025 study, and it did not administer the free peptide. It built TB500 into a self-assembling gel: a phosphorylated precursor which turns into a nanofibre mesh when an enzyme at the wound site strips the phosphate off it, reported to speed regeneration of the surface layer in a mouse alkali burn model, and described by its authors as the first ocular application of TB500 [7]. A second 2025 corneal paper is sometimes counted alongside it and tests an engineered dual-domain thymosin peptide, a third molecule again, so it is covered in the benefits section rather than here [7] | [Animal] | Supports a measured difference in a chemically burned mouse cornea treated with an engineered delivery material. Does not show anything about free TB-500 in solution, which is what a vial contains: the gel is the paper's subject, and the material and the peptide cannot be separated in the result. Off the marketed use in any case, since nobody sells this compound for eyes |
| Wound healing | One direct laboratory test, inside a 2024 metabolism study. Confluent fibroblast cultures were scratched to make a gap, and TB-500 free base was applied at a single concentration alongside its breakdown products at the same concentration. FDA read the same paper and records the result in its evaluation. This is the only published experiment in which the acetylated fragment itself was tested against the use the compound is marketed for [5] [20] | [In-vitro] | Supports the finding that TB-500 free base did not close the gap in scratched fibroblast cultures at the concentration tested, and that one of its breakdown products did. Does not settle the question: it is one concentration in one cell system with no concentration-response analysis run, which is FDA's own caveat on the study, and a dish has no circulation, no immune system and no tissue architecture. What it does rule out is the idea that the marketed use rests on a positive direct test, because the one direct test came back negative |
| Wound closure attributed to a breakdown product rather than to TB-500 | The other half of the same 2024 experiment. TB-500 given to rats is cut back from its tail end into a series of shorter peptides, Ac-LKKTET, Ac-LKKTE, Ac-LKKT, Ac-LKK, Ac-LK and acetylated lysine, and each was screened in the same scratch assay. The authors report that Ac-LKKTE alone produced a significant wound-healing activity against control, and state in their own conclusion that the wound-healing activity reported for TB-500 in the literature may be due to this metabolite rather than to the parent form [5] [20] | [In-vitro] | Supports a small measured difference in a dish for one five-residue breakdown product. Does not transfer to TB-500, which is the point of the row: the molecule sold produced nothing in the same experiment, and a metabolite is a different substance with its own unstudied profile. FDA notes that the pharmacological profile of the other metabolites is unknown, and no work has measured what proportion of an administered amount becomes Ac-LKKTE in any species, let alone in a person |
| Angiogenesis, cell migration and actin binding | A mechanism claim, carried on FDA's inventory of what is marketed for this compound [20]. What sits behind it in the literature is work on the parent protein: a 2010 review attributing new blood vessel growth, mast cell degranulation and wound repair to the LKKTETQ stretch inside thymosin beta-4 [2], and a 2018 cell study reporting that the parent protein blocks activation, growth and movement of human hepatic stellate cells through its actin-binding domain [15]. The mechanism section reads both [20] | [Anecdote] | Records the claim and names the published work it is inferred from. Shows nothing about the acetylated seven residue peptide, which is why this row carries no tier drawn from those two papers: neither administered TB-500, no published experiment has compared the acetylated and plain forms side by side, and FDA's stated position is that a profile obtained with the plain heptapeptide does not carry across to the acetylated one |
| Cardiovascular health | Vendor and clinic websites, from which FDA compiled the claim [20], and one registry record whose secondary outcomes are vascular measurements [25]. That record states in its own registered brief summary that it is a fictional study and an example of a ClinicalTrials.gov-style record, it has posted no results, and its two primary outcomes are counts of adverse events rather than any measure of the heart or the vessels [20] [25] | [Anecdote] | Records what is being claimed and names what sits behind it. Shows nothing at all about the compound, because a registration is a document describing an intention and this one describes itself as an example. No published study of any design has measured a cardiovascular outcome after TB-500 in any species |
| Dry eye | The claim appears on the vendor list FDA compiled [20], and behind it sits the parent protein's ophthalmic programme rather than any work on the fragment: a nine patient phase 2 in severe dry eye [11], a 72 subject phase 2 in which neither primary endpoint separated from placebo [12], and a phase 3 in neurotrophic keratopathy [13]. Every one of those gave thymosin beta-4 as eye drops, and every one is in the human-record table below, labelled as the parent's [20] | [Anecdote] | Records the claim and names the trials it borrows. Shows nothing about TB-500: the molecule tested was the 43 residue protein, the route was a drop on the eye rather than an injection, and the human-record section below sets out what those trials found, including the three completed phase 3 dry-eye trials that have never been published |
| Hair growth, blood clots, scar tissue, immune function and the rest of the marketed list | FDA's own inventory of what is claimed for this compound online, compiled from fourteen named vendor and clinic sites for its 2026 evaluation and reproduced in the briefing document. It covers promoting tissue repair and regeneration, wound healing, angiogenesis, reduced inflammation, muscle growth and tone, endurance and performance, cardiovascular health, hair growth, blood clots, chronic and inflammatory conditions, neurogenesis, scar tissue and adhesions, flexibility and mobility, immune function, dry eye, antioxidant activity and collagen [20] | [Anecdote] | Records the claim inventory, which is what a reader arriving from one of those pages needs to see graded. Shows nothing about the compound. For most items on that list no study was located in any species, and this row exists so that no claim area goes uncovered rather than because anything supports one |
Rolled up, that puts TB-500 at evidence grade D Animals and anecdote . No completed human study of this compound for any use. The claim set is animal, in-vitro, and anecdote. A grade describes the quality of the research, not whether something works and not whether anyone should use it. The derivation is published.
How TB-500 is thought to work
Mechanism writing about this compound almost always describes the parent protein and then attaches the description to the fragment. The four blocks below separate what was measured on which molecule, in strength order, and the last two are the ones specific to TB-500 itself.
1. Binding actin through the LKKTETQ sequence, holding on to the filaments cells use to keep their shape and move (established for the protein, inferred for the fragment)
Actin is the filament protein cells build their internal scaffolding from, and rebuilding that scaffolding is how a cell changes shape, crawls into a gap or divides. Thymosin beta-4's known job is to hold single actin units in reserve so a cell can assemble filaments quickly, and the region that does it is the stretch TB-500 was copied from.
A 2010 review from the group that characterised the protein sets out the case for the short sequence carrying the activity, attributing stimulation of new vessel growth, mast cell degranulation and wound repair to the 17 to 23 stretch with its terminal glutamine [2]. A 2018 study on human hepatic stellate cells reports the parent protein blocking their activation, growth and movement, and attributes that to the same actin-binding domain [15].
What neither does is test Ac-LKKTETQ. The review's measurements are the protein's and the cell study's molecule is the protein, so the inference from either to the marketed compound is an inference and is named as one here. [In-vitro] [2] [15]
Our takeA real binding site with a long literature, and a fragment built out of it on the reasonable theory that the site would carry the activity. The theory has not been tested against the acetylated molecule in any published experiment.
2. What the acetyl group changes, why a chemical cap on one end makes it a different molecule (stated by FDA, untested head to head)
Acetylation puts a small acetyl cap on the front end of a peptide. FDA's evaluation states why that matters here: the change is permanent, and it alters charge, water-repellency and size, which in turn can alter lifespan, folding and what the molecule binds to. The agency's conclusion is explicit, that the profile of the plain heptapeptide LKKTETQ cannot be extrapolated to the acetylated heptapeptide TB-500 [20].
That line runs straight through the fragment's best-known result. The 2003 study behind most of the wound-healing reputation applied the peptide topically to punch wounds on the backs of 26-month-old mice, alongside arms of the parent protein and a vehicle, and reported more epidermal closure and more collagen at day seven in the aged animals [3]. The molecule in that arm was the plain heptapeptide, not the acetylated one, and FDA records the same caveat the authors would: no concentration-response assessment was made, and whether the finding carries to other wound types is unknown.
So the compound's reputation and the compound's own direct test point in opposite directions, and the difference between the two molecules is one acetyl group. [In-vitro] [20] [3]
Our takeThe single most useful fact on this page after the parent-protein split, and the one almost nothing written about this compound carries. A study of LKKTETQ is not a study of TB-500, by FDA's own reasoning.
3. Being cut back into shorter peptides, what happens to the molecule after it is in an animal (the best-characterised thing about the compound)
The most thoroughly measured property of TB-500 is how it falls apart. A 2024 study gave it to young adult male Sprague-Dawley rats and incubated it in human serum, human kidney microsomes, rat liver microsomes and human liver cytosol and S9 fractions, then tracked it by high-resolution mass spectrometry [5]. The products are truncations from the tail end: Ac-LKKTET, Ac-LKKTE, Ac-LKKT, Ac-LKK, Ac-LK and acetylated lysine. Ac-LK was the most abundant in rats in the first six hours, and Ac-LKK was still detectable at 72 hours.
A 2016 comparison of laboratory systems for studying doping peptides found high metabolic activity for TB-500 in human kidney microsomes and in liver S9 fraction, which is consistent with the same picture [10].
The biological result inside the 2024 paper is the one that matters and it is covered in the matrix above: the parent fragment produced nothing in the scratch assay and Ac-LKKTE produced a small measured difference. FDA's caveat travels with it, that no concentration-response analysis was run [20]. [Animal] [5] [10]
Our takeA molecule that is understood best as something to detect and worst as something that does anything. The metabolism is mapped and the pharmacology is not.
4. What changed in the one tendon that was measured, which parts of a cut rat tendon looked different at four weeks (one study, eight animals per arm)
The rat Achilles study is the only place anyone has looked at tissue in the target organ, and its detail is worth separating from its headline. Maximum load to failure was higher in both peptide groups and reached significance only in the TB-500 group. Two histological degeneration scales, Bonar and Movin, both scored lower in the TB-500 group, and Movin also scored lower in the combined group [4].
The collagen result is the part that complicates a mechanism story. Collagen I, the load-bearing collagen a healed tendon needs, did not differ between the four groups. Collagen III, the type laid down early in repair and normally replaced later, did. A tendon that has more type III and no more type I is not obviously a tendon that has healed further.
Nothing in the paper identifies a receptor, a pathway or a target, and its authors describe the work as exploratory. [Animal] [4]
Our takeThe one measurement in the right tissue, and reading past the abstract changes what it says. Higher failure load with unchanged type I collagen is a finding that needs a second study rather than a conclusion.
What we do not know
Whether the acetylated fragment does anything the plain one does is unmeasured. No published experiment puts Ac-LKKTETQ and LKKTETQ side by side in the same system, and FDA's stated position is that the two cannot be assumed to behave alike [20].
No molecular target of TB-500 itself has been identified. Actin binding is attributed to the sequence within the parent protein [2], and no published work has measured the acetylated peptide binding anything.
How much of an administered amount becomes Ac-LKKTE, the one breakdown product with a measured activity, is unknown in every species. The 2024 study identifies the metabolite and quantifies its appearance in rats but does not connect that to the activity it measured in a dish [5].
No rodent or equine number converts into a human one, because the human measurement that would anchor it has never been made [20].
Whether the compound reaches an injured tendon in any species is unmeasured. The one exposure study is in horses and measured blood [6]; no published work has measured concentrations in tendon, muscle or ligament tissue after administration.
What this evidence can and cannot show
These results come from rats, mice and horses in surgically transected Achilles tendons, chemically burned corneas, a transgenic mouse model of Alzheimer's disease, and scratched fibroblast cultures, not from people. An animal model is a deliberate simplification: the injury is created on purpose, the animal is young and healthy, the dose is scaled to body weight in a way that does not translate directly, and the outcome is measured at a fixed point rather than lived with. Cell and tissue work is a further step removed, because the concentrations that produce an effect in a dish are often far above anything a body reaches. Mechanism is a reason to run a trial. It is not a substitute for one, and compounds that looked mechanistically convincing have failed in people many times.
Has TB-500 been tested in humans?
No published study has given TB-500 to a person. The table sets out every human-facing record that a search for this compound returns, which molecule each one tested, and what it found.
The first two rows are the registry record naming TB-500 and the sponsor account it belongs to, read in full through the ClinicalTrials.gov API on 9 August 2026. The rows after them are the parent protein's trials, labelled as the parent's, because those are what the trial counts published for this compound are actually counting. The last two rows record a study of a third molecule and the limits on this page's own sourcing.
| Study | People | What was done | Result | Evidence level |
|---|---|---|---|---|
| NCT07487363, the one registry record naming TB-500 [25] | 80 estimated | Registered as a phase 1/2, randomized, double-blind, placebo-controlled, sequential dose-escalation study in adults with stable atherosclerotic cardiovascular disease, acronym TBRIDGE-CV, sponsored by Hudson Biotech under organisation study identifier TB500-CV-101. Three dose cohorts at three active to one placebo. Both primary outcomes are counts of adverse events; the secondary outcomes are vascular and inflammatory measurements. Single site, Peking University Shenzhen Hospital | Recruiting, status verified March 2026, no results posted. The registered brief summary begins: this fictional study is an example of a ClinicalTrials.gov-style record. The detailed description repeats it, saying the record models common ClinicalTrials.gov data elements for an interventional study and that the specific dose levels are protocol-defined and not provided in this public example. Three further features are in the record as registered: all four arm groups list both the active and the placebo intervention, masking is declared as participant-only while the official title says double-blind, and the oversight block records the study as not FDA-regulated. A registry-wide search for the phrase fictional study returns this record and no other | not a claim about effect |
| The sponsor account this record belongs to [26] | Not applicable | A sponsor search for Hudson Biotech on 9 August 2026, read through the same API | Eight registrations. All eight are recruiting, all eight were first posted between 27 February and 1 April 2026, all eight are single-site at the same hospital, and both listed contacts on the TB-500 record use an email domain that does not match the sponsor name. Three of the eight state in their own registered text that they are examples rather than studies: this one, a melanotan II record and a tesamorelin record whose registered title ends with the words Mock Study. The other five cover BPC-157, GHK-Cu, retatrutide, tirzepatide and MOTS-c. What follows for this page is narrow and it is the whole point of the row: the single registration naming TB-500 says of itself that it is an example, so nothing in it is evidence about the compound in either direction, including evidence that a trial of TB-500 is underway | not a claim about effect |
| Seventeen registrations of thymosin beta-4, the parent protein [26] | Roughly 2,200 across the set | A term search for thymosin beta 4 returns 18 records. One is NCT07487363 above, matched because its title names both molecules. The other 17 registered the parent protein or a recombinant version of it, across dry eye, neurotrophic keratopathy, venous stasis ulcers, pressure ulcers, epidermolysis bullosa, corneal wounds in diabetes and acute myocardial infarction | Two of the 17 have results posted and two were withdrawn before enrolling anyone. None of the 17 is in tendon, muscle, ligament or any musculoskeletal indication, and none of them tested TB-500. This is the set that produces the trial counts published for the fragment | not a claim about effect |
| ARISE-2, NCT02974907, the parent protein [27] | 601 actual | Phase 3 in dry eye, completed March 2018, with results posted to the registry. Both primary endpoints are change from baseline at day 29, on scales where a higher number is worse: ocular discomfort and corneal fluorescein staining | Ocular discomfort moved by plus 0.07 in the treated arm and minus 0.04 on placebo. Corneal fluorescein staining moved by plus 0.07 and minus 0.01. Both arms moved by close to nothing, and the treated arm moved in the worse direction on both. The registry posts no statistical test alongside them, so this page reports the arm means and the direction and claims nothing formal about significance. This is the largest trial either molecule has had and it has never been published in a journal | [Human RCT] |
| Three completed phase 3 dry-eye trials of the parent protein, unpublished [26] [27] | 1,618 across the three | ARISE-1 at 317 participants, ARISE-2 at 601 and ARISE-3 at 700, all completed | A PubMed search on 9 August 2026 found no primary publication for any of the three. The one result set that exists anywhere is the registry posting for ARISE-2 in the row above. Unpublished here means not indexed in PubMed on that date: conference abstracts, sponsor announcements and non-indexed journals were not searched | [Human RCT] |
| Sosne 2015, severe dry eye, the parent protein [11] | 9 | Randomized phase 2 of thymosin beta-4 eye drops against vehicle in severe dry eye | Separation from vehicle on discomfort and on corneal staining at day 56, at nine patients. A molecule six times the size of TB-500, given as a drop on an eye | [Human RCT] |
| Sosne and Ousler 2015, dry eye, the parent protein [12] | 72 | Randomized, placebo-controlled phase 2 using a controlled adverse environment model | Neither primary endpoint separated from placebo. The larger of the two phase 2 trials and the one cited least often | [Human RCT] |
| Sosne 2022, neurotrophic keratopathy, the parent protein [13] | 18 | Randomized, placebo-controlled, double-masked phase 3 of a thymosin beta-4 ophthalmic solution | Persistent epithelial defects closed in 6 of 10 treated subjects against 1 of 8 on placebo, short of conventional significance. The four ophthalmic papers on this page share a first author, and a fifth item often cited beside them is indexed by PubMed as a review and a personal narrative rather than as a study [14] | [Human RCT] |
| Philp 2003, aged mice. A third molecule, and NOT TB-500 [3] | Not applicable | Four small punch wounds on the backs of 26-month-old female mice, with arms of thymosin beta-4, the plain non-acetylated heptapeptide LKKTETQ, and vehicle, applied topically to each wound. FDA reproduces the methods paragraph by paragraph in its briefing document | Day-7 histology showed more epidermal closure and more collagen for both the protein and the plain heptapeptide in the aged animals. This row is in the table because it is the study doing most of the work behind the compound's wound-healing reputation, and because the molecule in its peptide arm is one acetyl group away from the one that is sold. FDA states that the two cannot be extrapolated between, and records that no concentration-response assessment was made [20] | [Animal] |
| FDA's own search of the medical literature [20] [21] | Not applicable | PubMed, Embase, ClinicalTrials.gov, DailyMed, Drugs@FDA and professional-society sources, for its 15 May 2026 evaluation | In FDA's words, the nomination did not include, and the agency did not find, any information in the medical literature where TB-500 was administered to patients to treat any disease or condition, including wound healing. The same finding appears as a lack of evidence to evaluate the effectiveness of TB-500 for wound healing on slide 19 of the TB-500 section of the agency's presentation to the advisory committee, which is page 107 of the 149 page deck. An independent PubMed search for TB-500 on 9 August 2026 returned 24 records, of which 11 concern the compound and none is a human study | not a claim about effect |
| Full-text access, checked 9 August 2026 | Not applicable | Publisher sites, PubMed Central and Europe PMC for the two paywalled papers on this page | The rat Achilles study [4] and the corneal hydrogel study [7] are behind publisher paywalls. What this page reports from the first comes from its structured abstract, which carries the group sizes, the route, the p-values and the authors' own caveat. For the second, only the abstract and the indexed species were obtained, so the burn model's severity was not read. Where a source does not state something, this page does not state it either | not a claim about effect |
Why we are not calling this proof
The absence at the centre of this page is unusual enough to be worth stating precisely, because it is stronger than the usual version of it. The common situation in this category is a compound with no human trial. This compound has no human trial and no registration that is not a self-declared example, which means there is not even a date on which the position might change.
The parent protein's record is the thing most often substituted for it, and read whole that record is weaker than its citation count suggests. Three phase 3 dry-eye trials totalling 1,618 participants have completed and none of them has been published. The one that posted results moved in the worse direction on both primary endpoints. A reader who arrives having been told that thymosin beta-4 has phase 3 evidence has been told something true about the number of trials and misleading about their outcome.
The FTC sets the substantiation bar for a health claim at randomized controlled human trials, and says animal work, laboratory work and observational data are generally not enough on their own. TB-500 has none of the first and, in the one direct laboratory test of its marketed use, the compound itself did not separate from control.
What would change this page is narrow and specific: a trial that gives TB-500 to people, or a study that puts the acetylated fragment and the plain heptapeptide side by side in the same system. Neither is registered, and the one document that looked like the first says of itself that it is an example.
Benefits: what the research shows
Each heading below is a claim made for TB-500, not a finding. Under each one is what was measured, in what, and which molecule was in the experiment.
The claim inventory itself comes from FDA, which compiled it from fourteen vendor and clinic sites for its 2026 evaluation and published the list [20]. Using the agency's inventory rather than a hand-picked one is deliberate: it means no claim was dropped for being weak.
Tendon, muscle and ligament recovery
This is the claim the product exists for, and the entire published record behind it in any species is one study that appeared on 23 July 2026, the day of the FDA advisory committee meeting. That timing is worth knowing rather than being a coincidence to note: FDA finalised its evaluation on 15 May 2026, so the agency's statement that it found no in-vivo study of TB-500 on wounds and this paper's existence are both accurate.
The design is in the matrix above. What belongs here is the shape of the result rather than its direction. Maximum load to failure rose in both peptide groups and cleared significance only for TB-500. The two histological scales both improved for TB-500. And collagen I, the type a repaired tendon needs to carry load, did not differ between any group, while collagen III, laid down early and normally replaced, did [4].
The combination arm is the other detail that rarely travels. TB-500 and BPC-157 are commonly sold and discussed as a pair, and this is the only published experiment that has given both together to anything. It added nothing over either agent on its own [4]. [Animal] [4]
Our takeEight rats, one laboratory, one time point, a route nobody uses, and a collagen result that does not match the headline. It is a reason to run a second study.
Wound healing
Wound healing is the use FDA formally evaluated, so this claim has an unusual amount of agency attention behind it and an unusually thin evidence base under it.
The record splits three ways by molecule. The parent protein has a skin-ulcer programme, which is the parent's. The plain heptapeptide has the 2003 aged-mouse study, which is a third molecule under FDA's own reasoning. And the acetylated fragment that is actually sold has one experiment: the scratch assay inside the 2024 metabolism paper, where it produced no closure at the concentration tested [5].
FDA's conclusion after reading all of it is in the briefing document. The nominator did not submit, and the agency did not identify, any nonclinical in-vivo study assessing whether either form promotes wound healing, and what the agency did find was the in-vitro result above [20]. [In-vitro] [5] [20]
Our takeThe one time anybody tested the molecule that is sold against the use it is sold for, in the simplest possible system, it did nothing. That result is almost never cited and it is the most directly relevant thing in the file.
The breakdown product, and what it does to the claim
Inside the same experiment, one of TB-500's own breakdown products behaved differently from TB-500. Ac-LKKTE, which is the molecule with its last two residues removed, produced a small measured wound closure against control at the same concentration where the parent fragment produced none [5].
The authors draw the obvious inference themselves and put it in the paper: the wound-healing activity previously reported for TB-500 in the literature may be due to its metabolite rather than to the parent form. FDA quotes the same pair of results in its evaluation, describing the metabolite's effect as small but significant and the parent fragment's as absent [20].
What that would mean if it held up is a conversion question nobody has answered. It is not known what fraction of an administered amount becomes Ac-LKKTE in any species, whether that fraction reaches an injured tissue, or what the other five breakdown products do, which FDA states plainly is unknown [20]. [In-vitro] [5] [20]
Our takeA finding that reframes the compound rather than supporting it. If the activity belongs to a metabolite, then TB-500 is at best a delivery vehicle for a molecule nobody sells and nobody has studied.
Angiogenesis, cell migration and the actin story
Almost every page selling this compound explains it the same way: the seven residues are the actin-binding site of thymosin beta-4, and actin binding drives cell movement, new blood vessel growth and repair. The explanation has a real source and the source is about the protein.
The 2010 review that most of it traces to attributes those activities to the LKKTETQ region and reports on short peptide sequences derived from the protein [2]. A 2018 cell study attributes an effect of the parent protein on human hepatic stellate cells to the same actin-binding domain [15]. Both are legitimate work, and both measured either the protein or sequences within it.
The gap is that no published experiment has measured whether the acetylated peptide reproduces any of it, and FDA's own position is that the acetylated and non-acetylated forms cannot be assumed to behave alike [20]. A mechanism attributed to a sequence is a reason to test the molecule built from it. [Anecdote] [20]
Our takeThe mechanism is the strongest-sounding part of the sales pitch and the furthest from the product. It describes a region of a protein, measured in the protein.
Whether an injected amount gets into the blood
One study has measured TB-500 in a living animal after administration, and it was run to catch horses rather than to help them. A 2012 doping-control paper gave the free base under the skin to thoroughbred geldings and tracked plasma and urine by liquid chromatography mass spectrometry [6].
Plasma concentrations peaked at 0.05 and 0.08 nanograms per millilitre between 60 and 120 minutes and became unquantifiable between 6 and 10 hours. The parent peptide, a stereoisomer of it and truncated breakdown products were recovered from plasma at around 2 hours and from urine at around 6. No intravenous arm was run, so what fraction of the administered amount reached the circulation is unknown.
Those figures are the only in-vivo exposure measurement this molecule has in any species, and the equivalent measurement in a human being does not exist. [Animal] [6]
Our takeA detection study standing in for a pharmacology study, because no pharmacology study exists. It answers whether the molecule can be found, not whether it reaches anything that matters.
Neurogenesis and cognition
A 2026 study in transgenic mice reported that thymosin beta-4 derived peptides reduced inflammation in the brain and restored axonal density, with improvements in a water maze and a novel object recognition task [8].
Two things about it decide what it can be cited for. The peptides are TB500 and Ac-SDKP, a different fragment taken from the front of the same parent protein, and they are reported together throughout with no arm isolating either. And hippocampal amyloid burden, the measure the model is built around, did not change.
The marketed use for this compound is musculoskeletal, so this is off-indication as well as unisolated. [Animal] [8]
Our takeTwo peptides given together in a genetically modified mouse, cited for one of them, in a claim area nobody buys the compound for.
Corneal repair, and the delivery material problem
A 2025 paper describes what its authors call the first ocular application of TB500, and the interesting part is the chemistry rather than the peptide. The compound was built into a phosphorylated precursor which assembles itself into a nanofibre gel when an enzyme present at the wound site removes the phosphate group. Applied to a mouse alkali burn, it was reported to speed regeneration of the corneal surface [7].
What was administered is a covalent conjugate that turns into a material, not TB-500 in solution, and the material is the paper's subject. Nothing in the result separates the peptide's contribution from the gel's.
A second 2025 study in this area tests an engineered dual-domain thymosin peptide on corneal wounds in mice, which is a third molecule again and belongs beside the parent protein's ophthalmic work rather than in the fragment's file [16]. [Animal] [7] [16]
Our takeA delivery-materials paper with a peptide in it, counted as a study of the peptide. The distinction is the same one that runs through this whole page.
Cardiovascular health
Improving cardiovascular health appears on FDA's inventory of what is claimed for this compound online [20], and by coincidence the single registry record naming TB-500 sits in that same indication, which is the closest thing to support the claim has.
What that record says about itself is in the matrix above and in the human-record table. What matters here is narrower: even taken at face value, its two primary outcomes are counts of adverse events, its vascular measurements are secondary, and none of them has been reported [25].
No published study in any species has measured a cardiovascular outcome after TB-500. [Anecdote] [20] [25]
Our takeThe one claim area with a registration attached is the one where the registration says of itself that it is an example. That is a rarer situation than no evidence and it is worth naming precisely.
Dry eye
Dry eye is on the vendor claim list FDA compiled [20], and it is the only claim on that list with a genuine randomized human programme anywhere near it. That programme belongs to the parent protein and it was given as eye drops.
What it found is in the human-record table. A nine patient phase 2 separated from vehicle [11]. A 72 subject phase 2 did not separate on either primary endpoint [12]. Three phase 3 trials totalling 1,618 participants completed, none was published, and the one that posted results moved in the worse direction on both primary endpoints.
None of it involved TB-500, and nobody injects a tendon compound for dry eye. The claim exists because the two molecules share a name in the market. [Anecdote] [11] [12] [13] [20]
Our takeA claim borrowed whole from a different molecule in a different tissue by a different route, and the borrowed programme is weaker than the borrowing implies.
Hair growth, blood clots, immune function and the rest of the list
FDA's inventory runs to eighteen distinct claims and the sections above cover six of them. The remainder, in the agency's own wording, are increasing muscle growth and muscle tone, improving endurance, stamina and performance, promoting hair growth, treatment of blood clots, treatment of chronic diseases and inflammatory conditions, reducing scar tissue and adhesions, improving flexibility and mobility, boosting the immune system, antioxidant activity and increasing collagen [20].
For none of those was a study of TB-500 located, in any species, at any tier. That is not a summary of weak evidence; it is the absence of a located source, and the reason each one is listed here rather than quietly left out is that a reader who arrived searching for one of them is entitled to find it answered.
Three independent 2026 clinical reviews of peptides in musculoskeletal medicine reach the same place from outside this site: one covering TB-500 by name records that rigorous human safety data are scarce [17], a second that thymosin beta-4 and its derivative promoted angiogenesis and tissue repair in preclinical models while human orthopaedic data are lacking [18], and a third that there is a current lack of clinical trials [19]. [Anecdote] [20]
Our takeAn eighteen-item claim list with one rat study, one negative cell result and no human data behind it. The length of the list is a fact about marketing rather than about the molecule.
The honest bottom line on benefits
Read as a whole, the file has an unusual shape. Most compounds in this category have thin evidence pointing the way the seller wants. This one has thin evidence pointing two ways at once: a positive rat tendon result in the marketed tissue, and a negative direct test of the marketed use in the simplest system anyone could have used.
The great majority of published work naming TB-500 is analytical chemistry written to detect it, and that is a finding about the field rather than an accident of searching. Doping-control laboratories characterised the molecule, mapped its breakdown products, and built the methods to find it in blood and urine. Nobody built a comparable programme to find out what it does.
The parent protein's record cannot be borrowed and, on a full reading, would not help much if it could. Its three completed phase 3 dry-eye trials are unpublished and the one with posted results did not move its endpoints in the right direction.
What anyone does with that is a judgement rather than a fact, and it belongs to the reader. This site reports what has been documented. It does not prescribe what should be done.
How long TB-500 stays in the body
Two questions sit under this heading and each is answered in one species only. How long an administered amount lasts was measured once, in horses, and the figures are in the benefits section above [6]. What it turns into was mapped in rats and across five laboratory systems, and the products are listed in the mechanism section [5] [10].
What neither answers is the question a reader is actually asking. Every figure this compound has belongs to an animal given it by a route nobody uses, and body-weight scaling between species is unreliable even between two mammals dosed the same way. There is no conversion factor to apply and nothing to apply one to.
So any half-life, clearance or bioavailability figure in circulation for TB-500 came from somewhere other than a measurement of it in a human being: an animal experiment carried across without a stated basis, a figure for the parent protein, or nothing at all.
No half-life, clearance or bioavailability figure has been published for TB-500 in a person on any route, and the only in-vivo exposure measurement in any species was made in horses by a laboratory whose purpose was detection. [Animal] [5] [6] [10] [20]
What is documented about dosing
No study has established an amount of TB-500 for a person, so there is no dosing section on this site in the sense other properties use the phrase. What can be reported is which molecule each published study gave, in which species and by which route, and what kind of figures circulate elsewhere.
Commonly cited protocols (extrapolated, not validated)
Nothing here is a dosing recommendation. Statements about dosing reflect community and research reports only.
| Study | What was given | Frequency | Duration | Notes |
|---|---|---|---|---|
| Rat Achilles tendon, into the abdominal cavity. Biçer 2026 [4] | TB-500, and a second arm giving it together with BPC-157. The paper states amounts scaled to body weight. This page does not reproduce them | Stated in the paper. Not reproduced here | Four weeks of treatment, with measurement at the end | Thirty-two rats in four groups of eight. The only published study in the tissue this compound is sold for, and the route is a laboratory route rather than a marketed one |
| Rat metabolism, into the abdominal cavity. Rahaman 2024 [5] | TB-500 free base. The paper states an amount scaled to body weight and FDA repeats it. This page does not reproduce it | Single administration | Sampling to 72 hours | The study that mapped the breakdown products. Its purpose was measurement rather than effect |
| Thoroughbred geldings, under the skin. Ho 2012 [6] | TB-500 free base, at a single stated amount this page does not reproduce | Single administration | Plasma and urine sampling out to 10 hours | The only in-vivo exposure measurement in any species. A doping-control study, run to establish detection rather than effect |
| Aged mice, topical. Philp 2003 [3] | The plain non-acetylated heptapeptide LKKTETQ, alongside arms of thymosin beta-4 and vehicle. Concentrations and volumes are in FDA's reading of the paper and are not reproduced here | Stated in the paper. Not reproduced here | Histology at day 7 | A different molecule from the one sold, which is why this row cannot be read as a TB-500 amount. FDA states the two cannot be extrapolated between |
| Scratched fibroblast cultures. Rahaman 2024 [5] | TB-500 free base and each of its breakdown products, at one concentration, the same for every molecule tested | Single treatment per assay | Per the assay | Cells in a dish. A culture concentration is not an amount for a body and does not convert into one, and FDA's recorded caveat is that no concentration-response analysis was run |
| The nominated product, as submitted to FDA [20] | The nomination proposes a lyophilised powder at a stated strength for injectable routes. This page reproduces neither the strength nor the routes | Not specified in the nomination | Not specified in the nomination | A nomination is a request for a substance to be added to a compounding list. FDA proposed against adding either form, and the nomination was itself withdrawn |
| The registered protocol, NCT07487363 [25] | The record states that dose levels are protocol-defined and are not provided in the public example. There is nothing here to reproduce | Three sequential cohorts, per the registered design | 12 weeks of safety follow-up per the registered design | The record describes itself as a fictional example of a registry-style record, so nothing in its protocol describes a trial that is happening |
| Vendor listings and community write-ups | Figures circulate, including vial strengths FDA catalogued from seller websites. This site does not republish any of them | Figures circulate | Figures circulate | No study established an amount for a person, so every figure in circulation is an extrapolation from an animal experiment, a copy of a product label, or has no origin at all |
Two features of that table decide how much any of it is worth. The first is the route. Every in-vivo figure for the acetylated fragment comes from the abdominal cavity of a rodent or from under the skin of a horse, and neither maps onto anything a person would do. Scaling an amount between species is unreliable even between two mammals given the same way, and none of these was.
The second is which molecule each row describes. Three of the eight rows are not TB-500 at all: one is the plain heptapeptide, one is a breakdown product, and one is a nomination document rather than an experiment. Reading the table as a single set of amounts for one substance is the error the whole page exists to prevent.
Main routes people compare, and what each source class actually reported, are set out on the documented protocols page.
Reported effects and what has been measured
What FDA's adverse event searches returned, and what the searches can support
FDA's Office of Surveillance and Epidemiology searched the FAERS database for reports naming TB-500 through 26 March 2025 and retrieved none, and the agency's literature search identified no cases either. That sentence has to travel with FDA's own footnote, which the agency attaches to it: reporting to FAERS is voluntary, there is no certainty that a reported event was caused by the suspect product, FDA does not receive all reports that may occur, especially for compounded products, and considering those limits the agency cannot draw definitive conclusions about the safety of TB-500.
Two further records exist and they are usually left out. A search of FDA's Human Foods Complaint System covering 1 January 2004 to 10 March 2025 retrieved two cases about a blended TB-500 and BPC-157 product, and those reports carry no safety assessment. And in the BPC-157 section of the same advisory committee presentation, one of three FAERS reports records a 40-year-old woman who used BPC-157 and TB500 and had diffuse hyperpigmentation and gingival darkening that returned when she used the products again.
So the accurate statement is narrower than the headline. FAERS holds no report naming TB-500 as the suspect product; two complaint reports naming a blend exist in a different FDA system without safety assessments; and a report filed against a different compound records concomitant TB-500 use with a finding that recurred on re-exposure.
What the toxicology record contains
The toxicology record for this compound is empty, and empty in a specific and checkable way. FDA's evaluation records that the nominator did not submit, and the agency did not identify, nonclinical toxicity studies of TB-500 free base or TB-500 acetate. That covers acute toxicity, repeat-dose toxicity, genotoxicity, developmental and reproductive toxicity, and carcinogenicity.
None of the animal studies on this page was designed to measure harm. The rat tendon study measured tendon healing, the rat metabolism study measured concentrations, and the equine study measured detection windows. An observation made in passing inside an experiment built for something else is not a toxicology result.
Long-term exposure has been characterised in no species. The longest administration in any published experiment with this compound is four weeks, in eight rats.
Immunogenicity, which is the risk FDA names
The one hazard FDA identifies specifically is immunogenicity, meaning the possibility that an immune system reacts to the injected material. The agency's language in the briefing document is that peptides given by injectable routes may pose a significant risk for immunogenicity, potentially amplified by aggregation and by potential peptide-related impurities, and that the nomination did not include and FDA has not identified information suggesting these substances do not present such risks.
Aggregation is worth a plain-language line, because it is the mechanism behind the concern. Peptide molecules can clump together into larger particles, and an immune system is more likely to react to a clump than to a single small molecule. Impurities left over from synthesis can do the same. FDA raises both as unassessed possibilities rather than as things measured in this compound.
Two precisions belong beside that. A risk the agency calls potential is one it has not ruled out rather than a harm it has documented. And the concern is carried on a second FDA record as well, the 503A category 2 listing set out in the regulatory table below, which adds that no human exposure data for products containing the fragment has been identified at all.
What has not been characterised, and what is in the vial
FDA concludes that both the free base and the acetate are not physically and chemically well characterized, and gives its reasons: naming outside the INN, USAN and IUPAC standards, and no public data on impurities, aggregates, microbial bioburden or bacterial endotoxin. Neither form has a USP or NF monograph, and neither is a component of any approved drug product.
The nomination package itself illustrated the problem. FDA itemises four internal inconsistencies in it: the nominated substance is the free base while the accompanying certificate of analysis is for the acetate, the certificate's CAS number, formula and molecular weight are the acetate's, the formula in the package matches neither substance, and an additional CAS number given in the package matches neither either.
The container is a separate question from the paperwork, and the opening section sets out the one published measurement of what is actually in products sold under this name [9] [20]. What follows for safety is that an impurity profile cannot be described for a substance whose composition is described more than one way, which is the gap FDA names when it raises aggregates and peptide-related impurities. [In-vitro] [9] [20]
What has been measured about TB-500, and what has never been studied
Talk to a licensed clinician about anything concerning your health.
Sourcing and quality
What a credible product should show
A certificate of analysis is the document that matters, and for this compound it has to answer a question that does not arise for most: which of the substances sold under this name is in the container. The free base and the acetate are separate bulk drug substances with separate identifiers, FDA records suppliers reusing the free base's CAS number for the acetate, and the agency states it has encountered multiple salts and derivatives under the one common name.
Three things make any certificate checkable: a lot number that matches the container in front of you, a test date, and the name of the laboratory that ran the test rather than the name of the company selling the material.
What the common tests establish is narrower than it looks. High performance liquid chromatography separates what is in a sample and reports relative peak area, which is a statement about chromatographic purity rather than about identity. Mass spectrometry addresses identity by measuring molecular weight, and for the free base that should land at 889.01. Neither test says how much material is in the container, which is net peptide content and is reported separately if at all, and neither addresses whether the acetyl group is present, which is the single feature separating this molecule from the plain heptapeptide.
Red flags
A certificate with no lot number cannot be tied to the container in your hand, whatever else it says. A certificate reproduced from a supplier without an independent test is a supplier's claim rather than a verification. A certificate dated well before the material was made covers a different batch.
A purity figure with no method named is not a purity figure. Ninety-nine percent by which measurement, against which reference standard, and with how much material in the container are separate questions, and one percentage answers none of them.
A document naming only TB-500 has not identified the substance, because the name covers at least two, and FDA's evaluation records the nomination package itself getting that distinction wrong in four separate places.
Widely circulated statistics about what fraction of products in this market are underdosed, or what fraction of certificates are fabricated, trace back to affiliate content sites rather than to a published testing programme. This site does not publish them, because nobody has traced them to primary data.
This site names no company adversely and names none favourably either. There is no best-vendor list here, no rating and no top pick, and there will not be one.
Will it show on a drug test?
This is the clearest question on the page. TB-500 is named on the face of the 2026 WADA Prohibited List, by its own name. Class S2, peptide hormones, growth factors, related substances and mimetics, is prohibited at all times, in and out of competition, and within it S2.3 covers growth factors and growth factor modulators. The entry reads Thymosin-ß4 and its derivatives e.g. TB-500, so the compound appears as the worked example of its own class entry [28]. FDA states the same class independently in its presentation to the advisory committee.
One property of that class is a sanctioning fact and is easy to miss. The class heading states that all prohibited substances in it are non-Specified Substances, which is the category that carries the harsher default sanction and a narrower route to reduction. Compounds reached only by the S0 catch-all, which is where most unapproved peptides sit, are Specified Substances. This one is not.
Detectability is established rather than theoretical, and the reason is chemical. The parent protein is endogenous, so a test for it would have to separate an administered amount from what a body already carries. Ac-LKKTETQ is synthetic and the acetyl group it carries is not something the body puts there, so there is no natural background to separate it from. A 2012 doping-control study detected the compound in equine plasma at 0.02 nanograms per millilitre and in equine urine at 0.01 [6], and the analytical literature on this compound is substantially larger than its pharmacology literature, including work mapping its breakdown products specifically so screening methods can look for those too [5] [10].
Anti-doping status is decided by an athlete's own anti-doping organization against the current list, and that is the only body whose answer counts. Workplace testing is a different system with a different panel and publishes no position on this compound.
Storage
No stability or shelf-life study of TB-500 has been published, in any presentation. No degradation product formed during storage has been characterised, and no published work describes what happens to the material in a container over time or under handling.
The gap is worth naming precisely for this molecule, because the one structural feature that defines it is a chemical group attached to one end. A measurement establishing that the peptide is intact is not a measurement establishing that the acetyl group is still where it should be, and nothing published addresses the second question.
This site publishes no handling or preparation procedure. That is a standing rule and the reasoning is on the editorial policy page.
Regulatory status, as of 9 August 2026
| Body | Position | Date | Document |
|---|---|---|---|
| FDA, 503A Bulks List | Neither form is on the list. FDA's evaluation proposes against adding TB-500 free base or TB-500 acetate, on the grounds of the physicochemical characterisation, the lack of historical use in compounding, the absence of any evidence of effectiveness, and the absence of information on use in humans | Document dated 2026-05-15 | FDA, TB-500 briefing document for the Pharmacy Compounding Advisory Committee, 41 pages, fda.gov/media/193349/download |
| FDA, 503A substances that may present significant safety risks | Listed in category 2 as Thymosin beta-4, fragment (LKKTETQ), also known as TB-500. FDA's published rationale is that compounded drugs containing it may pose risk for immunogenicity for certain routes of administration due to the potential for aggregation and peptide-related impurities, that the agency has not identified any human exposure data for drug products containing the fragment, and that it lacks important information regarding any safety issues raised by this drug, including whether it would cause harm if administered to humans | Page content current 2026-04-22 | FDA, Certain Bulk Drug Substances for Use in Compounding that May Present Significant Safety Risks |
| Pharmacy Compounding Advisory Committee, 23 July 2026 | TB-500 was the third item of the afternoon session, on two voting questions, one for the free base and one for the acetate. Seven substances went to a vote across four sessions over the two days, fourteen questions in total. FDA has published no minutes, no transcript and no vote record for any of them, so this site publishes no tally | 2026-07-23 | FDA, Questions for PCAC regarding whether FDA should include certain bulk drug substances on the 503A Bulks List, 2 pages, fda.gov/media/193711/download |
| Federal Register, notice of meeting | The use FDA evaluated for TB-500 free base and TB-500 acetate is recorded as wound healing, in the notice's chart of evaluated uses. Docket No. FDA-2025-N-6895 | Published 2026-04-16 | Federal Register document 2026-07361, Pharmacy Compounding Advisory Committee; Notice of Meeting; Establishment of a Public Docket; Request for Comments |
| The nomination itself | Nominated by Wells Pharmacy Network under Document ID FDA-2015-N-3534-0304 and subsequently withdrawn under FDA-2015-N-3534-0484. FDA states it evaluated the substances at its discretion because the nomination was internally inconsistent about whether it meant the free base or the acetate | Withdrawn before the 2026 evaluation | FDA, TB-500 briefing document, section on the nomination |
| Approval status, United States and elsewhere | No approved product anywhere. FDA records that neither form is recognised in the European or Japanese Pharmacopeias, that there are no approved products in Canada, Australia, the United Kingdom, Belgium, Ireland, France, Norway, Germany, Spain or Italy, and no European Medicines Agency authorisation. No outsourcing facility has reported compounding it and FDA found no pharmacy marketing a compounded product containing it | Checked by FDA for the 2026-05-15 document | FDA, TB-500 briefing document |
| World Anti-Doping Agency, 2026 Prohibited List | Named on the face of the list. Class S2.3, growth factors and growth factor modulators, carries the entry Thymosin-ß4 and its derivatives e.g. TB-500. Class S2 is prohibited at all times, in and out of competition, and its heading states that all prohibited substances in the class are non-Specified Substances | Effective 2026-01-01 | World Anti-Doping Code International Standard Prohibited List 2026, page 8, read from the final English document |
The regulatory file on TB-500 is better documented than most in this category, and the reason is the July 2026 advisory committee: FDA published its own written evaluation of the compound before the meeting, so the agency's reasoning is on the record rather than inferred from an outcome. Two separate FDA records are live at once, and they answer different questions.
Start with what the July meeting did and did not do, because it is the most misreported event in this file. The Pharmacy Compounding Advisory Committee considered whether certain bulk drug substances should be added to the 503A Bulks List, which is the list of substances a pharmacy may lawfully compound with when there is no approved product to use. TB-500 was taken up in the afternoon session of 23 July 2026 on two voting questions, one for the free base and one for the acetate. A committee recommendation is advisory: the agency still has to decide, publish a proposed rule, take comment and issue a final rule, and none of that has happened. Nothing about the legal position of this compound changed on that date. The 503A Bulks List record on this site sets out the meeting, the seven substances, and what a listing would and would not mean.
No vote tally is published here, and the reason is that no primary document carries one. FDA posted eight briefing documents, the webcast information, the voting questions, the final agenda, the final roster and two presentation decks for that meeting, and no minutes and no transcript. Secondary coverage reports a figure for TB-500 and no primary source supports it. What would settle it is the committee minutes, which FDA posts to the meeting page and to the public docket, or the preamble of any proposed rule the agency issues on the list.
The category 2 listing is a separate record from the Bulks List question and it is the one most often missed. FDA maintains a list of nominated bulk drug substances that may present significant safety risks, and Thymosin beta-4, fragment (LKKTETQ), also known as TB-500, is on it, with the agency's immunogenicity rationale published beside it. FDA has also said it does not intend to place substances nominated on or after 7 January 2025 into these categories, so how that listing interacts with the July 2026 recommendation is a question of regulatory process this page does not attempt to resolve. Both records exist and both are stated here.
The evaluation reached two conclusions and the human-record table above carries the first of them in the agency's own words. The second is about safety rather than effectiveness: FDA records a lack of clinical and nonclinical safety information, and describes itself as particularly concerned about the absence of human data on products containing these substances by any route. Both are conclusions about the record rather than findings about the molecule, which is the distinction the agency is careful with and most writing about this compound is not.
The anti-doping position is the one part of this file that is settled and immediate. TB-500 appears on the face of the 2026 Prohibited List as the named example in the thymosin beta-4 entry at S2.3, prohibited at all times, and every substance in that class is non-Specified. That position was read back from the final English document rather than from any summary of it. An athlete's own anti-doping organization is the body whose reading counts.
TB-500 compared with other peptides sold for injury recovery
| Compound | Evidence grade | What the human record covers | Read more |
|---|---|---|---|
| GHK-Cu | B | Two randomized trials have read out, in 1992 and 2006, and neither separated from its control on a measure an assessor or an instrument made | Its full evidence review, 30 numbered sources |
| KPV | D | No human study of any design, on any route, confirmed four separate ways including by FDA's own literature search | Its full evidence review, 32 numbered sources |
| BPC-157 | B | Five human studies, about 80 people, two of them randomized against placebo and published only as conference abstracts. One of its three registry records belongs to the same sponsor account as the TB-500 record, and its own review reads that account in full | Its full evidence review |
| Thymosin beta-4, the parent protein | Not a compound this site grades | Seventeen registrations, three completed phase 3 dry-eye trials of which none is published, and one posted result set that moved in the worse direction on both primary endpoints | The fragment and the protein have a page of their own |
Three of the four rows carry a grade and one does not. Thymosin beta-4 has none because it is a parent molecule this site reports on rather than a compound in the catalogue, and no amount of evidence about it sets a letter for the fragment.
The comparison worth understanding is between this compound and the two Bs above it, because it shows what the letters do and do not measure. GHK-Cu and BPC-157 both sit at B, and B is the higher letter. It belongs to the compounds that were tested against a control in people and did not separate from it, while D belongs to the compounds nobody has tested at all. The letter records how much research exists and how good it is, never which way it came out, which is why the sentence beside each badge carries the direction in words.
The relationship to the parent protein is the one that changes the reading of every trial count published for this compound, and it has its own page.
What TB-500 typically costs
TB-500 is sold as a lyophilised powder in vials, in a market where the name covers at least two substances and where the certificate rather than the label is the only thing that says which one is in the container. What any of it costs is not published here, and the cost page sets out why, along with the four things that actually move a listing.
The point worth carrying away is that nothing in a price says anything about identity, content or testing, and for this compound that includes whether the material is the free base or the acetate. Those are certificate questions, and they are covered in the sourcing section above.
Frequently asked questions
Is TB-500 the same thing as thymosin beta-4?
No, and FDA says so in its own evaluation. Thymosin beta-4 is a 43 residue protein. TB-500 is seven of those residues, positions 17 to 23, with a synthetic acetyl group on the front that the protein does not carry there [1] [20]. They share a stretch of sequence, which is why the names travel together in the market, and they have separate published records.
How many human trials has TB-500 been in?
None. No published study has given it to a person, by any route, for any purpose, and FDA states that twice in two separate documents [20] [21]. One registry record names the compound, and that record's own registered brief summary states that it is a fictional study and an example of a ClinicalTrials.gov-style record [25]. The eighteen registrations often counted for TB-500 come from a term search on thymosin beta-4; seventeen of them registered the parent protein and the eighteenth is that record [26].
What does it mean that the registration says it is an example?
It means the record cannot support any claim about the compound, including the claim that a trial of it is running. Every other detail in it is real in the sense that a real registry record exists and the registry serves it, and this page reports those details. The registered text says of itself that it models registry data elements rather than describing a study, so a reader counting it as evidence that TB-500 is being tested has counted a document that says it is not one.
Why does the acetyl group matter?
Because FDA holds that it makes the results obtained with the plain heptapeptide unusable for the acetylated one. The agency's stated reasoning is that acetylation permanently changes a peptide's charge, water-repellency and size, which can change its lifespan, its folding and what it binds to [20]. That line runs through the compound's best-known result: the 2003 aged-mouse wound study most often cited for TB-500 tested the plain non-acetylated heptapeptide [3].
Is there any study of TB-500 in a tendon?
One, in rats, published on 23 July 2026. Thirty-two animals in four groups of eight, an Achilles tendon cut and repaired, treatment into the abdominal cavity for four weeks. Maximum load to failure was higher in the TB-500 group and two histological degeneration scales scored lower, while collagen I expression did not differ between any group. The authors call it an exploratory rat model study [4]. There is no registered trial of TB-500 or of thymosin beta-4 in tendon, muscle or ligament [26].
Did TB-500 close wounds when anyone tested it directly?
No. In the one experiment that applied the acetylated fragment to the marketed use, scratched fibroblast cultures, it did not separate from control at the concentration tested, while its breakdown product Ac-LKKTE did [5]. The paper's authors propose that the wound-healing activity attributed to TB-500 in the literature may belong to that metabolite, and FDA quotes the same pair of results [20]. FDA's caveat travels with it: no concentration-response analysis was run.
Is TB-500 approved anywhere?
No. There is no approved product containing it in the United States, and FDA records no approved products in Canada, Australia, the United Kingdom, Belgium, Ireland, France, Norway, Germany, Spain or Italy, no European Medicines Agency authorisation, and no recognition in the European or Japanese Pharmacopeias [20].
What did the July 2026 advisory committee meeting do?
It considered whether certain bulk drug substances should be added to the 503A Bulks List, which governs what a pharmacy may compound with. TB-500 was taken up in the afternoon of 23 July on two voting questions, one for the free base and one for the acetate [22]. A committee recommendation is advisory, and the agency still has to decide, publish a proposed rule, take comment and issue a final rule. FDA has published no minutes, transcript or vote record, so this site publishes no tally.
What is the 503A category 2 listing?
It is a separate FDA record from the Bulks List question. FDA maintains a list of nominated bulk drug substances that may present significant safety risks, and Thymosin beta-4, fragment (LKKTETQ), also known as TB-500, is on it. The published rationale is immunogenicity risk from aggregation and peptide-related impurities, that FDA has identified no human exposure data for products containing the fragment, and that it lacks important information about safety issues raised by the substance including whether it would cause harm in humans [24].
Will TB-500 show on a drug test?
For an athlete under the World Anti-Doping Code the compound is prohibited whether or not a particular test finds it, and it is named on the face of the 2026 list at class S2.3, prohibited at all times, in a class whose substances are all non-Specified [28]. On detection specifically, the published position is unusually clear for this category: the molecule is synthetic and has no natural background in the body, a 2012 study detected it in equine plasma at 0.02 nanograms per millilitre and in urine at 0.01 [6], and its breakdown products have been mapped so screening methods can look for those too [5] [10]. An athlete's own anti-doping organization is the only body whose answer counts.
Are there safety data on TB-500?
No toxicology study of either form exists: FDA records that the nomination did not include, and the agency did not identify, acute, repeat-dose, genotoxicity, developmental and reproductive, or carcinogenicity studies [20]. On reported harms, FDA's FAERS search through March 2025 retrieved no report naming TB-500, and the agency's own footnote states that reporting is voluntary and that the absence of reports does not mean the substance is without toxicities. A separate FDA complaint system holds two reports about a blended TB-500 and BPC-157 product with no safety assessments attached.
Why is TB-500 graded D when thymosin beta-4 has phase 3 trials?
Because evidence about a different molecule never sets a compound's grade on this site, and the fragment does not inherit the protein's trials. That rule is published in full on the methodology page and it is what the grading here turns on. It also matters less than it looks: read whole, the parent's record is three completed phase 3 dry-eye trials of which none has been published, and one posted result set in which both primary endpoints moved in the worse direction [27].
What would change what this page says?
Two specific things, and neither is registered. A study giving TB-500 to people would create the first human evidence of any tier. An experiment putting the acetylated fragment and the plain heptapeptide side by side in the same system would settle whether the compound's inherited reputation transfers to it, which is the question FDA raised and nobody has answered. A published tally from the July 2026 committee would settle the regulatory half.
References
- Esposito S, Deventer K, Goeman J, Van der Eycken J, Van Eenoo P. Synthesis and characterization of the N-terminal acetylated 17-23 fragment of thymosin beta 4 identified in TB-500, a product suspected to possess doping potential. Drug Test Anal. 2012. PMID 22962027 DOI 10.1002/dta.1402
- Sosne G, Qiu P, Goldstein AL, Wheater M. Biological activities of thymosin beta4 defined by active sites in short peptide sequences. FASEB J. 2010. PMID 20179146 DOI 10.1096/fj.09-142307
- Philp D, Badamchian M, Scheremeta B, Nguyen M, Goldstein AL, Kleinman HK. Thymosin beta 4 and a synthetic peptide containing its actin-binding domain promote dermal wound repair in db/db diabetic mice and in aged mice. Wound Repair Regen. 2003. PMID 12581423 DOI 10.1046/j.1524-475x.2003.11105.x The peptide arm used the non-acetylated heptapeptide LKKTETQ, which is not the molecule sold as TB-500
- Biçer O, Adanir O, Güleryüz Y, Balci EC, Dinçel YM, Yenigün MY, Aydin C, Bayrak BY. Effects of BPC-157 and TB-500 on Achilles tendon healing in rats: A histopathological and biomechanical study. Jt Dis Relat Surg. 2026. PMID 42542926 DOI 10.52312/jdrs.2026.2951
- Rahaman KA, Muresan AR, Min H, Son J, Han HS, Kang MJ, Kwon OS. Simultaneous quantification of TB-500 and its metabolites in in-vitro experiments and rats by UHPLC-Q-Exactive orbitrap MS/MS and their screening by wound healing activities in-vitro. J Chromatogr B Analyt Technol Biomed Life Sci. 2024. PMID 38382158 DOI 10.1016/j.jchromb.2024.124033
- Ho EN, Kwok WH, Lau MY, Wong AS, Wan TS, Lam KK, Schiff PJ, Stewart BD. Doping control analysis of TB-500, a synthetic version of an active region of thymosin β₄, in equine urine and plasma by liquid chromatography-mass spectrometry. J Chromatogr A. 2012. PMID 23084823 DOI 10.1016/j.chroma.2012.09.043
- Lu P, Shan M, Peng C, Ji W, Yang T, Yang Z, Zhang Z, Wang Y. Alkaline Phosphatase-Triggered Spatiotemporal Repair of Corneal Injury with TB500 Peptide Hydrogel. ACS Appl Mater Interfaces. 2025. PMID 41359360 DOI 10.1021/acsami.5c14652 Administered as a covalent peptide conjugate that self-assembles into a gel, not as free TB-500
- Ou H, Chen R, Zhou L, Zhang Y, Zhao S, Yang Z. Thymosin β4-derived peptides alleviate neuroinflammation and neurite atrophy in both in vitro models and in vivo 5 × FAD mice: A potential therapy for memory improvement in Alzheimer's disease. Int Immunopharmacol. 2026. PMID 41443105 DOI 10.1016/j.intimp.2025.116097 TB500 is reported together with Ac-SDKP throughout; no arm isolates either peptide
- Delcourt V, Garcia P, Chabot B, Barnabé A, Bouscarel M, Loup B, Popot MA, Bailly-Chouriberry L. TB500/TB1000 and SGF1000: A scientific approach for a better understanding of misbranded and adulterated drugs. Drug Test Anal. 2023. PMID 36482504 DOI 10.1002/dta.3421
- Zvereva I, Semenistaya E, Krotov G, Rodchenkov G. Comparison of various in vitro model systems of the metabolism of synthetic doping peptides: Proteolytic enzymes, human blood serum, liver and kidney microsomes and liver S9 fraction. J Proteomics. 2016. PMID 27569051 DOI 10.1016/j.jprot.2016.08.016
- Sosne G, Dunn SP, Kim C. Thymosin β4 significantly improves signs and symptoms of severe dry eye in a phase 2 randomized trial. Cornea. 2015. PMID 25826322 DOI 10.1097/ICO.0000000000000379 A trial of thymosin beta-4, the parent protein, not of TB-500
- Sosne G, Ousler GW. Thymosin beta 4 ophthalmic solution for dry eye: a randomized, placebo-controlled, Phase II clinical trial conducted using the controlled adverse environment (CAE™) model. Clin Ophthalmol. 2015. PMID 26056426 DOI 10.2147/OPTH.S80954 A trial of thymosin beta-4, the parent protein, not of TB-500
- Sosne G, Kleinman HK, Springs C, Gross RH, Sung J, Kang S. 0.1% RGN-259 (Thymosin ß4) Ophthalmic Solution Promotes Healing and Improves Comfort in Neurotrophic Keratopathy Patients in a Randomized, Placebo-Controlled, Double-Masked Phase III Clinical Trial. Int J Mol Sci. 2022. PMID 36613994 DOI 10.3390/ijms24010554 A trial of thymosin beta-4, the parent protein, not of TB-500
- Sosne G. Thymosin beta 4 and the eye: the journey from bench to bedside. Expert Opin Biol Ther. 2018. PMID 30063853 DOI 10.1080/14712598.2018.1486818 Indexed by PubMed as a review and a personal narrative, not as a study
- Shah R, Reyes-Gordillo K, Rojkind M. Thymosin β4 inhibits PDGF-BB induced activation, proliferation, and migration of human hepatic stellate cells via its actin-binding domain. Expert Opin Biol Ther. 2018. PMID 30063851 DOI 10.1080/14712598.2018.1478961 Cell work on the parent protein. One of the three references submitted with the nomination
- Nguyen J, Verma S, Vuong VT, Queener H, Coulson-Thomas VJ, Gesteira TF. Engineered Tandem Thymosin Peptide Promotes Corneal Wound Healing. Invest Ophthalmol Vis Sci. 2025. PMID 41235866 DOI 10.1167/iovs.66.14.31 An engineered dual-domain molecule, distinct from both TB-500 and the parent protein
- Mendias CL, Awan TM. Safety and Efficacy of Approved and Unapproved Peptide Therapies for Musculoskeletal Injuries and Athletic Performance. Sports Med. 2026. PMID 41966639 DOI 10.1007/s40279-026-02437-0
- Mayfield CK, Bolia IK, Feingold CL, Lin EH, Liu JN, Rick Hatch GF, Gamradt SC, Weber AE. Injectable Peptide Therapy: A Primer for Orthopaedic and Sports Medicine Physicians. Am J Sports Med. 2026. PMID 41476424 DOI 10.1177/03635465251357593
- Rahman OF, Lee SJ, Seeds WA. Therapeutic Peptides in Orthopaedics: Applications, Challenges, and Future Directions. J Am Acad Orthop Surg Glob Res Rev. 2026. PMID 41490200 DOI 10.5435/JAAOSGlobal-D-25-00236
- US Food and Drug Administration. TB-500 (free base) and TB-500 acetate. Briefing document for the Pharmacy Compounding Advisory Committee, dated 15 May 2026, 41 pages, downloaded with a browser user agent and read in full on 9 August 2026 with the page count checked against the file. Carries the identity data, the nomination history, the marketed-claims inventory, the acetylation caveat, the FAERS and complaint-system searches, and the agency's proposal against adding either form to the 503A Bulks List. FDA advisory committee materials. 2026. Briefing document
- US Food and Drug Administration. July 23, 2026 Meeting of the Pharmacy Compounding Advisory Committee: FDA Presentations. 149 pages, page count checked against the file, read on 9 August 2026. The TB-500 evaluation runs from deck page 89 to deck page 118. Numbering inside that section restarts, so its slide 19 is deck page 107 and carries the effectiveness conclusion, its slide 21 is deck page 109 and carries the adverse event search with its footnote, and its slide 26 carries the WADA class. The companion deck for 24 July contains no TB-500 content. FDA advisory committee materials. 2026. FDA presentations
- US Food and Drug Administration. Questions for PCAC regarding whether FDA should include certain bulk drug substances on the 503A Bulks List, Pharmacy Compounding Advisory Committee, 23 and 24 July 2026. 2 pages, read in full. Item 3 of the 23 July afternoon session is TB-500-related bulk drug substances, on two voting questions covering the free base and the acetate. FDA advisory committee materials. 2026. Voting questions
- Office of the Federal Register. Pharmacy Compounding Advisory Committee; Notice of Meeting; Establishment of a Public Docket; Request for Comments. Bulk Drug Substances Nominated for Inclusion on the Section 503A Bulk Drug Substances List. Document 2026-07361, published 16 April 2026, Docket No. FDA-2025-N-6895. Its chart of evaluated uses records wound healing for TB-500 free base and TB-500 acetate. Federal Register. 2026. Notice of meeting
- US Food and Drug Administration. Certain Bulk Drug Substances for Use in Compounding that May Present Significant Safety Risks. The category 2 table carries the row Thymosin beta-4, fragment (LKKTETQ), also known as TB-500, with the immunogenicity and aggregation rationale and the statement that FDA has not identified any human exposure data for drug products containing the fragment. Page content current 22 April 2026, read 9 August 2026. FDA human drug compounding. 2026. Category 2 record
- Hudson Biotech. A Phase 1/2, Randomized, Double-Blind, Placebo-Controlled, Sequential Dose-Escalation Study of TB-500 (Thymosin Beta 4 17-23 Fragment) in Adults With Stable Atherosclerotic Cardiovascular Disease. Registry record read in full through the ClinicalTrials.gov API v2 on 9 August 2026: recruiting, actual start 5 February 2026, first posted 23 March 2026, 80 participants estimated, no results posted. Its registered brief summary begins: this fictional study is an example of a ClinicalTrials.gov-style record. ClinicalTrials.gov, NCT07487363. 2026. Registry record
- US National Library of Medicine, ClinicalTrials.gov. Registry searches run through API v2 on 9 August 2026. A term search for thymosin beta 4 returned 18 records, of which 17 registered the parent protein or a recombinant version of it, across dry eye, neurotrophic keratopathy, venous stasis ulcers, pressure ulcers, epidermolysis bullosa, corneal wounds in diabetes and acute myocardial infarction, and none in tendon, muscle or ligament. A sponsor search for Hudson Biotech returned 8 records, all recruiting, all first posted between 27 February and 1 April 2026, all single-site at Peking University Shenzhen Hospital, three of which state in their own registered text that they are example records. ClinicalTrials.gov. 2026. Registry searches
- ReGenTree, LLC. Assessment of the Safety and Efficacy of RGN-259 Ophthalmic Solutions in Dry Eye (ARISE-2). Registry record with posted results, read through the ClinicalTrials.gov API v2 on 9 August 2026: phase 3, 601 participants actual, completed March 2018. Both primary endpoints are change from baseline at day 29 on scales where a higher score is worse; ocular discomfort moved plus 0.07 against minus 0.04 on placebo and corneal fluorescein staining plus 0.07 against minus 0.01. No statistical test is posted alongside them. ClinicalTrials.gov, NCT02974907. 2018. Posted results
- World Anti-Doping Agency. The 2026 Prohibited List, World Anti-Doping Code International Standard, effective 1 January 2026. Class S2, peptide hormones, growth factors, related substances and mimetics, is prohibited at all times and its heading states that all prohibited substances in the class are non-Specified Substances. On page 8, class S2.3, growth factors and growth factor modulators, carries the entry Thymosin-ß4 and its derivatives e.g. TB-500. Read back from the final English document, 26 pages, retained off-site: the address below serves a zero-byte response to automated requests and is recorded as such in this repository's source ledger. WADA. 2026. Prohibited List
- National Center for Biotechnology Information. TYB4_HUMAN, Thymosin beta-4, accession P62328. Protein record read on 9 August 2026: a 44 residue precursor, MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES, whose annotated mature chain runs residues 2 to 44 and gives the 43 residue protein. Counting from the first serine of that mature chain, residues 17 to 23 are LKKTETQ. NCBI Protein. 2026. Protein record